Anti-Wnt7a Polyclonal Antibody

Product code: 39-2011

Clonality : Polyclonal
Application : WB, IHC-P
Reactivity : Human, Mouse, Rat

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
100 μg/vial
$622.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Format : Lyophilized
Amount : 100 μg/vial
Isotype : Rabbit IgG
Purification : Immunogen affinity purified.
Content : Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. Reconstitute : Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage condition : At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Gene : WNT7A
Gene ID : 7476
Uniprot ID : O00755
Alternative Name : Protein Wnt-7a; WNT7A
Immunogen Information : A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related Mouse sequence.
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas – Rothschild / Schinzel phocomelia syndromes.

Western blot : 0.1-0.5μg/ml; Immunohistochemistry(Paraffin-embedded Section) : 0.5-1μg/ml

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Post transnational modification: Palmitoleoylation is required for efficient binding to frizzled receptors. Depalmitoleoylation leads to Wnt signaling pathway inhibition.
Tissue Specificity: Expression is restricted to placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain.
BioGrid: 113313. 31 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products