-->

rIL 1 beta Recombinant Protein

Product code: 32-1370

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
10 µg
$388.00 


Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com


Amount : 10 µg
Purification : Greater than 97.0% as determined by SDS-PAGE.
Content : The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
Storage condition : Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
AA sequence : MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
Alternative Name : Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Source : Escherichia Coli. Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.The IL-1b is purified by proprietary chromatographic techniques. Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews

Customers who purchased this product also purchased