Recombinant S. plicatus Endo- beta-N-Acetylglucosaminidase H/Endo H (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 5mM PB, 500mM NaCl, pH 7.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MAPAPVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRTPLEHHHHHH |
| Uniprot ID : | P04067 |
Source: E.coli.
MW :30.23kD.
Recombinant S.plicatus Endo H is produced by our E.coli expression system and the target gene encoding Pro42-Pro313 is expressed with a 6His tag at the C-terminus. Endoglycosidase H is a recombinant glycosidase which belongs to the glycosyl hydrolase 18 family. It is a highly specific endoglycosidase which cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins, but not highly processed complex oligosaccharides from glycoproteins. It is used for research purposes to deglycosylate glycoproteins
MW :30.23kD.
Recombinant S.plicatus Endo H is produced by our E.coli expression system and the target gene encoding Pro42-Pro313 is expressed with a 6His tag at the C-terminus. Endoglycosidase H is a recombinant glycosidase which belongs to the glycosyl hydrolase 18 family. It is a highly specific endoglycosidase which cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins, but not highly processed complex oligosaccharides from glycoproteins. It is used for research purposes to deglycosylate glycoproteins
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
