Recombinant S. cerevisiae TIM16(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,300mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA |
Source: E.coli.
MW :7.9kD.
Recombinant S. cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM16 is produced by our E.coli expression system and the target gene encoding Thr54-Ala119 is expressed. Mitochondrial import inner membrane translocase subunit TIM16 (TIM16) is an ssential component of the PAM complex. PAM complex is required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, TIM16 is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. TIM16 may act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation.
MW :7.9kD.
Recombinant S. cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM16 is produced by our E.coli expression system and the target gene encoding Thr54-Ala119 is expressed. Mitochondrial import inner membrane translocase subunit TIM16 (TIM16) is an ssential component of the PAM complex. PAM complex is required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, TIM16 is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. TIM16 may act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Mitochondrion inner membrane |
| BioGrid: | 33652. 414 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
