Recombinant Mouse VEGF-D/PIGF (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSVDHHHHHH |
Source: Human Cells.
MW :13.1kD.
Recombinant Mouse Vascular Endothelial Growth Factor D is produced by our Mammalian expression system and the target gene encoding Phe98-Ser206 is expressed with a 6His tag at the C-terminus. Mouse vascular endothelial growth factor D, (VEGFD) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. VEGFD is a secreted protein and highly expressed in fetal and adult lung. It undergoes a complex proteolytic maturation, generating multiple processed forms that bind and activate VEGFR-2 and VEGFR-3 receptors. The structure and function of this protein is similar to VEGFC. VEGFD is growth factor which active in angiogenesis, lymphangiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels.
MW :13.1kD.
Recombinant Mouse Vascular Endothelial Growth Factor D is produced by our Mammalian expression system and the target gene encoding Phe98-Ser206 is expressed with a 6His tag at the C-terminus. Mouse vascular endothelial growth factor D, (VEGFD) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. VEGFD is a secreted protein and highly expressed in fetal and adult lung. It undergoes a complex proteolytic maturation, generating multiple processed forms that bind and activate VEGFR-2 and VEGFR-3 receptors. The structure and function of this protein is similar to VEGFC. VEGFD is growth factor which active in angiogenesis, lymphangiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | Undergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3 and VEGFR-2. VEGF-D first form an antiparallel homodimer linked by disulfide bonds before secretion. The fully processed VEGF-D is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions (By similarity). |
Tissue Specificity: | Highly expressed in fetal and adult lung. |
BioGrid: | 199673. 2 interactions. |
There are currently no product reviews
|