Recombinant Mouse Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGGVDHHHHHH |
Source: Human Cells.
MW :26.4kD.
Recombinant Mouse Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Val23-Gly258 is expressed with a 6His tag at the C-terminus. Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) is a member of the Tumor Necrosis Factor Receptor Superfamily. TNFRSF1B contains four TNFR-Cys repeats. TNFRSF1B can be cleaved into the following 2 chains: Tumor necrosis factor receptor superfamily member 1b and membrane form and Tumor necrosis factor-binding protein 2. TNFRSF1B is a receptor with high affinity for TNFSF2/TNF-a and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-a. TNFRSF1B mediates most of the metabolic effects of TNF-a. TNF-a-induced apoptosis suggests that it regulates TNF-a function by antagonizing its biological activity.
MW :26.4kD.
Recombinant Mouse Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Val23-Gly258 is expressed with a 6His tag at the C-terminus. Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) is a member of the Tumor Necrosis Factor Receptor Superfamily. TNFRSF1B contains four TNFR-Cys repeats. TNFRSF1B can be cleaved into the following 2 chains: Tumor necrosis factor receptor superfamily member 1b and membrane form and Tumor necrosis factor-binding protein 2. TNFRSF1B is a receptor with high affinity for TNFSF2/TNF-a and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-a. TNFRSF1B mediates most of the metabolic effects of TNF-a. TNF-a-induced apoptosis suggests that it regulates TNF-a function by antagonizing its biological activity.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
