Recombinant Mouse Transforming Growth Factor- beta Receptor Type II/TGFBR2 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDVDHHHHHH |
Source: Human Cells.
MW :16.2kD.
Recombinant Mouse TGF beta receptor II is produced by our Mammalian expression system and the target gene encoding Ile24-Asp159 is expressed with a 6His tag at the C-terminus. Transforming growth factor- beta (TGF- beta) is an essential regulator in the processes of development, cell proliferation, and extracellular matrix deposition. TGF- beta regulates cellular processes by binding to three high-affinity cell surface receptors: TGF- beta receptor type I (TGF- beta-RI), TGF- beta receptor type II (TGF- beta-RII), and TGF- beta beta receptor type III (TGF- beta-RIII). TGF- beta RII is consists of a C-terminal protein kinase domain and an N-terminal ectodomain and belongs to transforming growth factor-beta (TGF- beta) receptor subfamily. TGF- beta RII has a protein kinase domain which can form a heterodimeric complex with another receptor protein and bind TGF-beta. This receptor/ligand complex phosphorylates protein will enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.
MW :16.2kD.
Recombinant Mouse TGF beta receptor II is produced by our Mammalian expression system and the target gene encoding Ile24-Asp159 is expressed with a 6His tag at the C-terminus. Transforming growth factor- beta (TGF- beta) is an essential regulator in the processes of development, cell proliferation, and extracellular matrix deposition. TGF- beta regulates cellular processes by binding to three high-affinity cell surface receptors: TGF- beta receptor type I (TGF- beta-RI), TGF- beta receptor type II (TGF- beta-RII), and TGF- beta beta receptor type III (TGF- beta-RIII). TGF- beta RII is consists of a C-terminal protein kinase domain and an N-terminal ectodomain and belongs to transforming growth factor-beta (TGF- beta) receptor subfamily. TGF- beta RII has a protein kinase domain which can form a heterodimeric complex with another receptor protein and bind TGF-beta. This receptor/ligand complex phosphorylates protein will enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Membrane raft |
| Post transnational modification: | Phosphorylated on a Ser/Thr residue in the cytoplasmic domain. |
| Tissue Specificity: | Widely expressed in adult. Expressed primarily in mesenchyme and epidermis of the midgestational fetus. |
| BioGrid: | 204164. 4 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
