Recombinant Mouse TRANCE/RANK L/TNFSF11(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
Source: E.coli.
MW :20.1kD.
Recombinant Mouse TNF ligand superfamily member 11 is produced by our expression system and the target gene encoding Gln137-Asp316 is expressed. Mouse tumor necrosis factor ligand superfamily member 11(Tnfsf11) is a member of the tumor necrosis factor (TNF) cytokine family. Tnfsf11 is widely expressed in cells including T cells and T cell rich organs, such as thymus and lymph nodes. This cytokine can bind to TNFRSF11B/OPG andTNFRSF11A/RANK. Tnfsf11 is involved in a number of fundamental biological processes such as acting as regulator of interactions between T-cells and dendritic cells, the regulation of the T-cell-dependent immune response and enhancing bone-resorption in humoral hypercalcemia of malignancy. It augments the ability of dendritic cells to stimulate naive T-cell proliferation.
MW :20.1kD.
Recombinant Mouse TNF ligand superfamily member 11 is produced by our expression system and the target gene encoding Gln137-Asp316 is expressed. Mouse tumor necrosis factor ligand superfamily member 11(Tnfsf11) is a member of the tumor necrosis factor (TNF) cytokine family. Tnfsf11 is widely expressed in cells including T cells and T cell rich organs, such as thymus and lymph nodes. This cytokine can bind to TNFRSF11B/OPG andTNFRSF11A/RANK. Tnfsf11 is involved in a number of fundamental biological processes such as acting as regulator of interactions between T-cells and dendritic cells, the regulation of the T-cell-dependent immune response and enhancing bone-resorption in humoral hypercalcemia of malignancy. It augments the ability of dendritic cells to stimulate naive T-cell proliferation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The soluble form of isoform 1 derives from the membrane form by proteolytic processing. The cleavage may be catalyzed by ADAM17. A further shorter soluble form was observed. |
| Tissue Specificity: | Highly expressed in thymus and lymph nodes, but not in non-lymphoid tissues and is abundantly expressed in T-cells but not in B-cells. A high level expression is also seen in the trabecular bone and lung. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
