Recombinant Mouse TACI/TNFRSF13B/CD267 (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :41.4kD.
Recombinant Mouse Transmembrane Activator and CAML Interactor is produced by our Mammalian expression system and the target gene encoding Phe5-Thr129 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 13B, also known as TNFRSF13B or more commonly as TACI (transmembrane activator and CAML interactor), is a transmembrane receptor protein found predominantly on the surface of B cells, which are an important part of the immune system.
MW :41.4kD.
Recombinant Mouse Transmembrane Activator and CAML Interactor is produced by our Mammalian expression system and the target gene encoding Phe5-Thr129 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 13B, also known as TNFRSF13B or more commonly as TACI (transmembrane activator and CAML interactor), is a transmembrane receptor protein found predominantly on the surface of B cells, which are an important part of the immune system.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
