Recombinant Mouse SLAM Family Member 9/SLAMF9/CD2F-10 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | FSGDDEDPEEVIGVLQESINLSLEIPSNEEIKHIDWLFQNNIAIVKPGKKGQPAVITAVDPRYRGRVSISESSYSLHISNLTWEDSGLYNAQVNLKTSESHITKSYHLRVYRRLSKPHITVNSNISEEGVCNISLTCSIERAGMDVTYIWLSSQDSTNTSHEGSVLSTSWRPGDKAPSYTCRVSNPVSNISSRRISVGSFCADPGYPEKPSMLVDHHHHHH |
Source: Human Cells.
MW :24.7kD.
Recombinant Mouse SLAMF9 is produced by our Mammalian expression system and the target gene encoding Phe18-Leu230 is expressed with a 6His tag at the C-terminus. Mouse SLAM family member 9(Slamf9) is a single-pass type I membrane protein. The SLAMF9 gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. The slamf9 protein may play a role in the immune response.
MW :24.7kD.
Recombinant Mouse SLAMF9 is produced by our Mammalian expression system and the target gene encoding Phe18-Leu230 is expressed with a 6His tag at the C-terminus. Mouse SLAM family member 9(Slamf9) is a single-pass type I membrane protein. The SLAMF9 gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. The slamf9 protein may play a role in the immune response.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
