Recombinant Mouse Platelet Receptor Gi24/VISTA/B7-H5 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAHHHHHH |
Source: Human Cells.
MW :18.6kD.
Recombinant Mouse Platelet receptor Gi24 is produced by our Mammalian expression system and the target gene encoding Phe33-Ala191 is expressed fused with a 6His tag at the C-terminus. Mouse Platelet receptor Gi24(VISTA) is a transmembrane glycoprotein with homology to B7like immune costimulatory molecules. Mature mouse Gi24 contains a 159 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane segment, and a 97 aa cytoplasmic domain. VISTA promotes both MT1-MMP expression and the MT1-MMP mediated activation of MMP-2. It supports the differentiation of embryonic stem cells (ESC) and enhances BMP-4 induced signaling in ESC, but it is also down-regulated following BMP-4 exposure. It binds to BMP-4 directly and also associates with the type I BMP receptor Activin RIB/ALK-4. It is expressed on the surface of naïve CD4+ T cells and regulatory T cells. It is up-regulated in vivo on activated monocytes and dendritic cells. VISTA inhibits CD4+ and CD8+ T cell proliferation and their production of IL-2 and IFN- gamma . Its expression on tumor cells attenuates the antitumor immune response and enables more rapid tumor progression.
MW :18.6kD.
Recombinant Mouse Platelet receptor Gi24 is produced by our Mammalian expression system and the target gene encoding Phe33-Ala191 is expressed fused with a 6His tag at the C-terminus. Mouse Platelet receptor Gi24(VISTA) is a transmembrane glycoprotein with homology to B7like immune costimulatory molecules. Mature mouse Gi24 contains a 159 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane segment, and a 97 aa cytoplasmic domain. VISTA promotes both MT1-MMP expression and the MT1-MMP mediated activation of MMP-2. It supports the differentiation of embryonic stem cells (ESC) and enhances BMP-4 induced signaling in ESC, but it is also down-regulated following BMP-4 exposure. It binds to BMP-4 directly and also associates with the type I BMP receptor Activin RIB/ALK-4. It is expressed on the surface of naïve CD4+ T cells and regulatory T cells. It is up-regulated in vivo on activated monocytes and dendritic cells. VISTA inhibits CD4+ and CD8+ T cell proliferation and their production of IL-2 and IFN- gamma . Its expression on tumor cells attenuates the antitumor immune response and enables more rapid tumor progression.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cell membrane |
Post transnational modification: | N-glycosylated. |
Tissue Specificity: | Expressed in spleen, thymus, bone marrow, lymph node, and in T-cells within the lamina propria of the small intestine (PubMed:21768399). Detected on CD4+ and CD8+ T-cells, bone marrow-derived dendritic cells (BMDCs), peritoneal macrophages, neutrophils, and natural killer (NK) cells (PubMed:21768399). In spleen and lymph nodes, highly expressed on CD4+ T-cell populations, and at lower levels on CD8+ T-cells (PubMed:21383057). In thymus, has low expression on CD4+ cells and CD8+ cells, and not detected on CD4+CD8+ cells (PubMed:21383057). Expressed in splenic and peritoneal CD11b cells (PubMed:21383057). Not detected in most B cells and NK cells (at protein level) (PubMed:21383057). Also detected at lower levels in non-hematopoeitic tissues such as heart, brain, lung, kidney, muscle, ovary, and testis (PubMed:21768399, PubMed:21383057). |
There are currently no product reviews
|