Recombinant Mouse PDCD1/PD-1/CD279 (C-6His)

Product code: 32-8569

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $321.00 

  • $404.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQVDHHHHHH
Gene : Pdcd1
Gene ID : 18566
Uniprot ID : Q02242
Source: Human Cells.
MW :17.2kD.
Recombinant Mouse Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Leu25-Gln167 is expressed with a 6His tag at the C-terminus. Programmed Death-1 (PD-1), firstly cloned from mouse T cell hybridoma 2B4.11, is one member of CD28/CTLA-4 superfamily. PD-1 belongs to type I transmembrane protein and acts as an important immunosuppressive molecule. The cytoplamsic tail of PD-1 contains two structural motifs, an immunoreceptor tyrosine-based inhibitory motif (ITIM) and an immunoreceptor tyrosine-based switch motif (ITSM) formed by two tyrosine residues which make the difference in PD-1 signal mediating. Mouse PD-1 is expressed in thymus and shares about 69% aa sequence identity with human PD-1. Recently, programmed death-1 (PD-1) with its ligands, programmed death ligand B7H1 (PD-L1) and B7DC (PD-L2), was found to regulate T-cell activation and tolerance, upon ligand binding, inhibiting T-cell effector functions in an antigen-specific manner. PD-1 gene knocked out mice would induce some autoimmune diseases, which suggests that PD-1 acts as a co-inhibitory molecule actively participating in maintaining peripheral tolerance. Thus, PD-1 may be a useful target for the immunologic therapy of carcinoma,infection,autoimmune diseases as well as organ transplantation.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Membrane
Tissue Specificity: Thymus.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products