Recombinant Mouse Kallikrein 1/mGK-6 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH7.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAENDVDHHHHHH |
Source: Human Cells.
MW :27.9kD.
Recombinant Mouse Kallikrein-1 is produced by our Mammalian expression system and the target gene encoding Pro19-Asp261 is expressed with a 6His tag at the C-terminus. Kallikreins belongs to the family of trypsin-like serine proteases, many of which are associated with a variety of cancers. Kallikrein 1 (KLK1) is also known as tissue kallikrein and urinary kallikrein. KLK1 is synthesized as a 261 amino acid (aa) protein that contains a 18 aa signal peptide and a 241 aa proprotein. An important physiological function of KLK1 cleaves Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Kinins regulate vasodilation, blood pressure reduction, smooth muscle relaxation and contraction, pain induction and inflammation.
MW :27.9kD.
Recombinant Mouse Kallikrein-1 is produced by our Mammalian expression system and the target gene encoding Pro19-Asp261 is expressed with a 6His tag at the C-terminus. Kallikreins belongs to the family of trypsin-like serine proteases, many of which are associated with a variety of cancers. Kallikrein 1 (KLK1) is also known as tissue kallikrein and urinary kallikrein. KLK1 is synthesized as a 261 amino acid (aa) protein that contains a 18 aa signal peptide and a 241 aa proprotein. An important physiological function of KLK1 cleaves Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Kinins regulate vasodilation, blood pressure reduction, smooth muscle relaxation and contraction, pain induction and inflammation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
