Recombinant Mouse HLADG/CD74 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTLVDHHHHHH |
Source: Human Cells.
MW :19.4kD.
Recombinant Mouse CD74 is produced by our Mammalian expression system and the target gene encoding Gln56-Leu215 is expressed with a 6His tag at the C-terminus. Mouse HLA class II histocompatibility antigen gamma chain (CD74), is a single-pass type II membrane protein that in humans is encoded by the CD74 gene. It contains 1 thyroglobulin type-1 domain. CD74 Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
MW :19.4kD.
Recombinant Mouse CD74 is produced by our Mammalian expression system and the target gene encoding Gln56-Leu215 is expressed with a 6His tag at the C-terminus. Mouse HLA class II histocompatibility antigen gamma chain (CD74), is a single-pass type II membrane protein that in humans is encoded by the CD74 gene. It contains 1 thyroglobulin type-1 domain. CD74 Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| BioGrid: | 200600. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
