Recombinant Mouse Frizzled 1/FZD1 (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :46.8kD.
Recombinant Mouse Frizzled 1 is produced by our Mammalian expression system and the target gene encoding Val69-His248 is expressed with a Fc tag at the C-terminus. Frizzled homolog 1 (FZD1), also known as Frizzled-1, a member of the G-protein-coupled receptor superfamily, mediates Wnt signaling by serving as a co-receptor with LRP-5 for Wnt ligands. The FZD1 protein contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, 7 transmembrane domains, and a C-terminal PDZ domain-binding motif.
MW :46.8kD.
Recombinant Mouse Frizzled 1 is produced by our Mammalian expression system and the target gene encoding Val69-His248 is expressed with a Fc tag at the C-terminus. Frizzled homolog 1 (FZD1), also known as Frizzled-1, a member of the G-protein-coupled receptor superfamily, mediates Wnt signaling by serving as a co-receptor with LRP-5 for Wnt ligands. The FZD1 protein contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, 7 transmembrane domains, and a C-terminal PDZ domain-binding motif.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane, Cell membrane |
| Post transnational modification: | Ubiquitinated by ZNRF3, leading to its degradation by the proteasome. |
| Tissue Specificity: | Expressed in chondrocytes. |
| BioGrid: | 199775. 3 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
