Recombinant Mouse Folate Receptor Alpha/FOLR1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSVDHHHHHH |
Source: Human Cells.
MW :25.3kD.
Recombinant Mouse Folate Receptor Alpha is produced by our Mammalian expression system and the target gene encoding Thr25-Ser232 is expressed with a 6His tag at the C-terminus. Folate Receptor alpha belongs to the folate receptor family and it is a 37 - 42 kDa protein that mediates the cellular uptake of folic acid and reduced folates.. Mature FOLR1 is an N-glycosylated protein that is anchored to the cell surface by a GPI linkage. FOLR1 can be detected in kidney proximal tubules. It is critically required during early embryogenesis as shown in knockout mice which die in utero with gross morphological defects. FOLR1 binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. It Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation. Required for renal folate reabsorption.
MW :25.3kD.
Recombinant Mouse Folate Receptor Alpha is produced by our Mammalian expression system and the target gene encoding Thr25-Ser232 is expressed with a 6His tag at the C-terminus. Folate Receptor alpha belongs to the folate receptor family and it is a 37 - 42 kDa protein that mediates the cellular uptake of folic acid and reduced folates.. Mature FOLR1 is an N-glycosylated protein that is anchored to the cell surface by a GPI linkage. FOLR1 can be detected in kidney proximal tubules. It is critically required during early embryogenesis as shown in knockout mice which die in utero with gross morphological defects. FOLR1 binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. It Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation. Required for renal folate reabsorption.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Secreted, Cytoplasmic vesicle, Cytoplasmic vesicle, Endosome, Apical cell membrane |
| Post transnational modification: | The secreted form is derived from the membrane-bound form either by cleavage of the GPI anchor, or/and by proteolysis catalyzed by a metalloprotease. |
| Tissue Specificity: | Detected in kidney proximal tubules (at protein level). |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
