Recombinant Mouse Fibroblast Growth Factor 17/FGF-17 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl,EDTA,DTT, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQTLEHHHHHH |
Source: E.coli.
MW :23.7kD.
Recombinant Mouse Fibroblast Growth Factor 17 is produced by our expression system and the target gene encoding Thr23-Thr216 is expressed with a 6His tag at the C-terminus. FGF-17 is a member of the fibroblast growth factor (FGF) family. FGFs share 30 70% amino acid (aa) identity in a conserved, approximately 120 amino acid core domain. FGFs play multiple roles in biological functions, including angiogenesis, mitogenesis, cell differentiation and wound repair. FGF17 plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. It is also expressed in hindgut, parts of the developing skeleton, tail bud, major arteries, and heart. In many of these areas, it is expressed along with FGF-8, but slightly later. It is required for normal brain development.
MW :23.7kD.
Recombinant Mouse Fibroblast Growth Factor 17 is produced by our expression system and the target gene encoding Thr23-Thr216 is expressed with a 6His tag at the C-terminus. FGF-17 is a member of the fibroblast growth factor (FGF) family. FGFs share 30 70% amino acid (aa) identity in a conserved, approximately 120 amino acid core domain. FGFs play multiple roles in biological functions, including angiogenesis, mitogenesis, cell differentiation and wound repair. FGF17 plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. It is also expressed in hindgut, parts of the developing skeleton, tail bud, major arteries, and heart. In many of these areas, it is expressed along with FGF-8, but slightly later. It is required for normal brain development.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
