Recombinant Mouse Ephrin-A4/EFNA4 (C-Fc)

Product code: 32-7890

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $303.00 

  • $358.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : RHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene : Efna4
Gene ID : 13639
Uniprot ID : O08542
Source: Human Cells.
MW :44kD.
Recombinant Mouse Ephrin-A4 is produced by our Mammalian expression system and the target gene encoding Arg27-Gly176 is expressed with a Fc tag at the C-terminus. Ephrin-A4 belongs to the ephrin family and Contains 1 ephrin RBD (ephrin receptor-binding) domain. The protein is cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Ephrin-A4 binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. It may play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cell membrane
Tissue Specificity: Expressed in myogenic progenitor cells.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products