Recombinant Mouse Endothelial Cell-Specific Molecule /Endocan/ESM-1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRVDHHHHHH |
Source: Human Cells.
MW :19kD.
Recombinant Mouse ESM-1 is produced by our Mammalian expression system and the target gene encoding Trp20-Arg184 is expressed with a 6His tag at the C-terminus. Endothelial cell-specific molecule–1 (ESM-1)—so-called endocan—is a novel endothelium derived soluble dermatan sulfate proteoglycan (PG) that is constitutively expressed by endothelial cells in lungs and kidneys and can be detected in human blood. It is encoded by the ESM1 gene. The expression of this gene is regulated by several cytokines and growth factors, such as vascular endothelial growth factor. Inflammatory cytokines, such as interleukin (IL)-1 beta and tumor necrosis factor (TNF)-a, stimulate the upregulation of endocan mRNA and the secretion of endocan from endothelial cells. The binding of circulating endocan to leukocyte ligand for ICAM-1—Lymphocyte Function-associated Antigen-1 (LFA-1) and to leukocyte ligand for VCAM-1—Very Late Antigen-4 (VLA-4) is important in leukocyte adhesion and interaction with activated endothelium. Endocan is a key player in the regulation of major processes such as cell adhesion in inflammatory disorders and tumor progression.
MW :19kD.
Recombinant Mouse ESM-1 is produced by our Mammalian expression system and the target gene encoding Trp20-Arg184 is expressed with a 6His tag at the C-terminus. Endothelial cell-specific molecule–1 (ESM-1)—so-called endocan—is a novel endothelium derived soluble dermatan sulfate proteoglycan (PG) that is constitutively expressed by endothelial cells in lungs and kidneys and can be detected in human blood. It is encoded by the ESM1 gene. The expression of this gene is regulated by several cytokines and growth factors, such as vascular endothelial growth factor. Inflammatory cytokines, such as interleukin (IL)-1 beta and tumor necrosis factor (TNF)-a, stimulate the upregulation of endocan mRNA and the secretion of endocan from endothelial cells. The binding of circulating endocan to leukocyte ligand for ICAM-1—Lymphocyte Function-associated Antigen-1 (LFA-1) and to leukocyte ligand for VCAM-1—Very Late Antigen-4 (VLA-4) is important in leukocyte adhesion and interaction with activated endothelium. Endocan is a key player in the regulation of major processes such as cell adhesion in inflammatory disorders and tumor progression.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | O-glycosylated; contains chondroitin sulfate and dermatan sulfate. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
