Recombinant Mouse Dermatopontin/DPT (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QYGGYGYPYQQYQDYGDDGWVNLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDMISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDCEFENVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :49.1kD.
Recombinant Mouse Dermatopontin is produced by our Mammalian expression system and the target gene encoding Gln19-Val201 is expressed with a Fc tag at the C-terminus. Dermatopontin is a widely expressed noncollagenous protein component of the extracellular matrix. It is a 22 kDa molecule that is tyrosine sulfated but not glycosylated. Dermatopontin is down regulated in fibrotic growths such as leiomyoma and scar tissue, inhibits cell proliferation, accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation, Dermatopontin deficient mice exhibit altered collagen matrix deposition and organization. Dermatopontin seems to mediate adhesion by cell surface integrin binding, may serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment, and enhances TGFB1 activity (By similarity). Dermatopontin promotes bone mineralization under the control of the vitamin D receptor and inhibits BMP-2 effects on osteoblast precursors.
MW :49.1kD.
Recombinant Mouse Dermatopontin is produced by our Mammalian expression system and the target gene encoding Gln19-Val201 is expressed with a Fc tag at the C-terminus. Dermatopontin is a widely expressed noncollagenous protein component of the extracellular matrix. It is a 22 kDa molecule that is tyrosine sulfated but not glycosylated. Dermatopontin is down regulated in fibrotic growths such as leiomyoma and scar tissue, inhibits cell proliferation, accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation, Dermatopontin deficient mice exhibit altered collagen matrix deposition and organization. Dermatopontin seems to mediate adhesion by cell surface integrin binding, may serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment, and enhances TGFB1 activity (By similarity). Dermatopontin promotes bone mineralization under the control of the vitamin D receptor and inhibits BMP-2 effects on osteoblast precursors.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Sulfated on tyrosine residue(s). |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
