Recombinant Mouse C-X-C Motif Chemokine 16/CXCL16/SR-PSOX (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4 . |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH |
Source: Human Cells.
MW :20.1kD.
Recombinant Mouse C-X-C motif chemokine 16 is produced by our Mammalian expression system and the target gene encoding Asn27-Trp201 is expressed with a 6His tag at the C-terminus. CXCL16 is a single-pass type I membrane protein, which consists of 246 amino acids, CXCL16 induces a strong chemotatic response and calcium mobilization. CXCL16 acts as a scavenger receptor on macrophages, which specially binds to oxidized low density lipoprotein. CXCL16 may involves in pathophysiology such as atherogenesis. Soluble CXCL16 may play an important role in liver metastases through the induction of epithelial-mesenchymal transition.
MW :20.1kD.
Recombinant Mouse C-X-C motif chemokine 16 is produced by our Mammalian expression system and the target gene encoding Asn27-Trp201 is expressed with a 6His tag at the C-terminus. CXCL16 is a single-pass type I membrane protein, which consists of 246 amino acids, CXCL16 induces a strong chemotatic response and calcium mobilization. CXCL16 acts as a scavenger receptor on macrophages, which specially binds to oxidized low density lipoprotein. CXCL16 may involves in pathophysiology such as atherogenesis. Soluble CXCL16 may play an important role in liver metastases through the induction of epithelial-mesenchymal transition.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Post transnational modification: | Glycosylated. |
| Tissue Specificity: | Widely expressed. Not detected in purified B- and T-cells. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
