Recombinant Mouse C-C Motif Chemokine 21a/CCL21a//6Ckine
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
Source: E. coli.
MW :12kD.
Recombinant Mouse C-C Motif Chemokine 21a is produced by our E.coli expression system and the target gene encoding Ser24-Gly133 is expressed. C-C Motif Chemokine 21a (CCL21a) is a small secreted cytokine that belongs to the intercrine beta (CC chemokine) family. Mouse CCL21 cDNA encodes a 133 amino acid residue protein with a 23 residue signal peptide that is cleaved to generate the 110 residue mature protein. Mouse CCL21 has three forms while CCL21a has Ser-65. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7 and CXCR3. Mouse CCL21 inhibits hemopoiesis and stimulates chemotaxis. It has chemotactic function in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Mouse CCL21 shows preferential activity towards naive T-cells and may play a role in mediating homing of lymphocytes to secondary lymphoid organs.
MW :12kD.
Recombinant Mouse C-C Motif Chemokine 21a is produced by our E.coli expression system and the target gene encoding Ser24-Gly133 is expressed. C-C Motif Chemokine 21a (CCL21a) is a small secreted cytokine that belongs to the intercrine beta (CC chemokine) family. Mouse CCL21 cDNA encodes a 133 amino acid residue protein with a 23 residue signal peptide that is cleaved to generate the 110 residue mature protein. Mouse CCL21 has three forms while CCL21a has Ser-65. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7 and CXCR3. Mouse CCL21 inhibits hemopoiesis and stimulates chemotaxis. It has chemotactic function in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Mouse CCL21 shows preferential activity towards naive T-cells and may play a role in mediating homing of lymphocytes to secondary lymphoid organs.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed strongly in lung, spleen, thymus, peripheral and mesentric lymph nodes. Also expressed in the testis, kidney, liver, and heart. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
