Recombinant Mouse beta-Nerve Growth Factor/ beta-NGF (Ser122-Gly241)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG |
Source: E.coli.
MW :13.5kD.
Recombinant Mouse beta-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Ser122-Gly241 is expressed. Mouse beta-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. beta-NGF is a potent neurotrophic factor that signals through its receptor beta-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta-NGF also acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival.
MW :13.5kD.
Recombinant Mouse beta-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Ser122-Gly241 is expressed. Mouse beta-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. beta-NGF is a potent neurotrophic factor that signals through its receptor beta-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta-NGF also acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 201764. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
