Recombinant Mouse Basigin/CD147 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRHHHHHH |
Source: Human Cells.
MW :34.1kD.
Recombinant Mouse Basigin is produced by our Mammalian expression system and the target gene encoding Ala22-Arg325 is expressed with a 6His tag at the C-terminus. Basigin/CD147 is a member of the immunoglobulin superfamily with homology to both the immunoglobulin V domain and MHC class II antigen beta-chain. This protein play important roles in variety of events including spermatogenesis, embryo implantation, neural network formation. CD147 induces the production and release of matrix metalloproteinases (MMP) in the surrounding mesenchymal cells and tumor cells, and thereby promotes invasion, metastasis, growth and survival of malignant cells. Furthermore, CD147 also serves as a receptor for extracellular cyclophilinthe and its association with integrins might be important in signal transduction. CD147 displays increased expression in many cancers, and it has been previously demonstrated to participate in cancer metastasis and progression.
MW :34.1kD.
Recombinant Mouse Basigin is produced by our Mammalian expression system and the target gene encoding Ala22-Arg325 is expressed with a 6His tag at the C-terminus. Basigin/CD147 is a member of the immunoglobulin superfamily with homology to both the immunoglobulin V domain and MHC class II antigen beta-chain. This protein play important roles in variety of events including spermatogenesis, embryo implantation, neural network formation. CD147 induces the production and release of matrix metalloproteinases (MMP) in the surrounding mesenchymal cells and tumor cells, and thereby promotes invasion, metastasis, growth and survival of malignant cells. Furthermore, CD147 also serves as a receptor for extracellular cyclophilinthe and its association with integrins might be important in signal transduction. CD147 displays increased expression in many cancers, and it has been previously demonstrated to participate in cancer metastasis and progression.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Melanosome |
| Post transnational modification: | N-glycosylated. During spermatogenesis, probably deglycosylated during epididymal transit. |
| Tissue Specificity: | Isoform 1 is specifically expressed in retina. Isoform 2 is widely expressed, including adult organs, embryos and EC cells. Expressed in spermatozoa. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
