Recombinant Macaca mulatta (Rhesus macaque) a-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | APHGPGLIYRQPNCDDPETEEAALVAVDYINQNLPWGYKHTLNQIDEVKVWPQQPFGEMFEIEIDTLETTCHVLDPTPVAGCRVRQLKEHAVEGDCDFQLLKVNGKFSVEYAKCDSSPDSAEDVRKVCRDCPLLAPLNDTRVVHAAEAAVTAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTISGTDCVAKEATEAANCNLLAKKQYGFCKATLNEKLGGEEVAVTCTVFQTQPATSQPQPEGANEAVPTPVVDADAPASYPVGASGPLPTGSPIYAHVLAAAPPVVPIHSSHYDLRHLFMGVVSLRSPSGEALHPRKTRSVVQPSVGAAAGPVVPPCPGRVRHFKVHHHHHHHHHH |
| Gene : | AHSG |
| Uniprot ID : | F6WRS6 |
Source: Human Cells.
MW :38.9kD.
Recombinant Macaca mulatta (Rhesus macaque) Fetuin A is produced by our Mammalian expression system and the target gene encoding Ala19-Val367 is expressed with a 10His tag at the N-terminus. Alpha-2-HS-glycoprotein (AHSG) is a glycoprotein that is composed of two subunits, the A and B chains, belongs to the Cystatin family of proteases inhibitors. It is highly expressed in embryonic cells and adult hepatocytes, and is expressed to a lesser extent in monocytes/macrophages. AHSG is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. In addition, AHSG may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages. ASHG blocks TGF-beta-dependent signaling in osteoblastic cells.
MW :38.9kD.
Recombinant Macaca mulatta (Rhesus macaque) Fetuin A is produced by our Mammalian expression system and the target gene encoding Ala19-Val367 is expressed with a 10His tag at the N-terminus. Alpha-2-HS-glycoprotein (AHSG) is a glycoprotein that is composed of two subunits, the A and B chains, belongs to the Cystatin family of proteases inhibitors. It is highly expressed in embryonic cells and adult hepatocytes, and is expressed to a lesser extent in monocytes/macrophages. AHSG is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. In addition, AHSG may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages. ASHG blocks TGF-beta-dependent signaling in osteoblastic cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
