Recombinant Human Zinc Finger Protein 70/ZNF70 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL |
Source: E.coli.
MW :53kD.
Recombinant Human Zinc Finger Protein 70 is produced by our E.coli expression system and the target gene encoding Met1-Leu446 is expressed with a 6His tag at the N-terminus. Zinc Finger Protein 70 (ZNF70) is a member of the krueppel C2H2-type zinc-finger protein family. ZFN70 is localized to the cell nucleus and contains eleven C2H2-type zinc fingers. ZFN70 has sequence-specific DNA binding transcription factor activity, and it may be involved in transcriptional regulation. In addition, ZFN70 has the DNA-binding and metal-binding activity, which can bind zinc ion.
MW :53kD.
Recombinant Human Zinc Finger Protein 70 is produced by our E.coli expression system and the target gene encoding Met1-Leu446 is expressed with a 6His tag at the N-terminus. Zinc Finger Protein 70 (ZNF70) is a member of the krueppel C2H2-type zinc-finger protein family. ZFN70 is localized to the cell nucleus and contains eleven C2H2-type zinc fingers. ZFN70 has sequence-specific DNA binding transcription factor activity, and it may be involved in transcriptional regulation. In addition, ZFN70 has the DNA-binding and metal-binding activity, which can bind zinc ion.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| BioGrid: | 113441. 10 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
