Recombinant Human Zinc Finger HIT Domain-Containing Protein 1/ZNHIT1/ZNFN4A1 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,50% Glycerol,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV |
Source: E. coli.
MW :19.6kD.
Recombinant Human Zinc Finger HIT Domain-Containing Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Val154 is expressed with a 6His tag at the N-terminus. ZNHIT1 belongs to the ZNHIT1 family and contains one HIT-type zinc finger. It can be phosphorylated on Thr by MAPK11 or MAPK14. ZNHIT1 is a component of the chromatin-remodeling SRCAP complex, which is composed of at least SRCAP, DMAP, RUVBL1, RUVBL2, ACTL6A, YEATS4, ACTR6 and ZNHIT1. ZNHIT1 may play a role in p53-mediated apoptosis induction.
MW :19.6kD.
Recombinant Human Zinc Finger HIT Domain-Containing Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Val154 is expressed with a 6His tag at the N-terminus. ZNHIT1 belongs to the ZNHIT1 family and contains one HIT-type zinc finger. It can be phosphorylated on Thr by MAPK11 or MAPK14. ZNHIT1 is a component of the chromatin-remodeling SRCAP complex, which is composed of at least SRCAP, DMAP, RUVBL1, RUVBL2, ACTL6A, YEATS4, ACTR6 and ZNHIT1. ZNHIT1 may play a role in p53-mediated apoptosis induction.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| Post transnational modification: | Stres-induced ZNHIT1 is mainly regulated at the level of protein. |
| Tissue Specificity: | Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine. |
| BioGrid: | 115730. 29 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
