Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)(Discontinued)
Fig-1: Recombinant Human Xaa-Pro Aminopeptidase P3 was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as Lyophilized from a 0.2 µm filtered solution in PBS with 5% trehalose, pH 7.4 Reconstitute sterile water. |
| Storage condition : | Store at -20°C, stable for 12 months as lyophilized, 2-8 oC for 1 month under sterile condition after reconstitution. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPFILSADCPKEMNDIEQICSQASLEHHHHHH |
Source: E. coli.
MW :55.7kD.
Recombinant Human Aminopeptidase P3 is produced by our E.coli expression system and the target gene encoding Met1-Ser507 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Probable Xaa-Pro Aminopeptidase 3 (XPNPEP3) is a member of the peptidase M24B family. XPNPEP3 has two isoforms and both are widely expressed. XPNPEP3 is localized in the Mitochondrion. XPNPEP3 catalyzes the release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide. Defects in XPNPEP3 are the cause of nephronophthisis-like nephropathy type 1 which is a disorder with features of nephronophthisis, a cystic kidney disease leading to end-stage renal failure.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Mitochondrion |
| Tissue Specificity: | Isoform 1 and isoform 2 are widely expressed, with isoform 1 being more abundant. |
| BioGrid: | 121997. 27 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
