Recombinant Human Vitelline Membrane Outer Layer Protein 1 Homolog/VMO1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 0.5mM EDTA, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRSVDHHHHHH |
Source: Human Cells.
MW :20.07kD.
Recombinant Human VMO1 is produced by our Mammalian expression system and the target gene encoding Gln25-Ser202 is expressed with a 6His tag at the C-terminus. Vitelline membrane outer layer protein 1 homolog (VMO1) belongs to the VMO1 family is a 202 amino acid secreted protein. Exact function not known, component of the outer membrane of the vitelline layer of the egg. Seems to be able to synthesize N-acetylchito-oligosaccharides (n=14-15) from hexasaccharides of N-acetylglucosamine in a manner similar to the transferase activity of lysozyme.
MW :20.07kD.
Recombinant Human VMO1 is produced by our Mammalian expression system and the target gene encoding Gln25-Ser202 is expressed with a 6His tag at the C-terminus. Vitelline membrane outer layer protein 1 homolog (VMO1) belongs to the VMO1 family is a 202 amino acid secreted protein. Exact function not known, component of the outer membrane of the vitelline layer of the egg. Seems to be able to synthesize N-acetylchito-oligosaccharides (n=14-15) from hexasaccharides of N-acetylglucosamine in a manner similar to the transferase activity of lysozyme.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
