Recombinant Human VIP36-Like Protein/LMAN2L (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLAVDHHHHHH |
Source: Human Cells.
MW :34.4kD.
Recombinant Human LMAN2L is produced by our Mammalian expression system and the target gene encoding Ser19-Ala313 is expressed with a 6His tag at the C-terminus. VIP36-like protein (LMAN2L) is a single-pass type I membrane protein and contains 1 L-type lectin-like domain. It is highly expressed in skeletal muscle and kidney, and its intermediate expression levels in heart, liver and placenta, low levels in brain, thymus, spleen, small intestine and lung. LMAN2L may be involved in the regulation of export from the endoplasmic reticulum of a subset of glycoproteins. It also may function as a regulator of ERGIC-53.
MW :34.4kD.
Recombinant Human LMAN2L is produced by our Mammalian expression system and the target gene encoding Ser19-Ala313 is expressed with a 6His tag at the C-terminus. VIP36-like protein (LMAN2L) is a single-pass type I membrane protein and contains 1 L-type lectin-like domain. It is highly expressed in skeletal muscle and kidney, and its intermediate expression levels in heart, liver and placenta, low levels in brain, thymus, spleen, small intestine and lung. LMAN2L may be involved in the regulation of export from the endoplasmic reticulum of a subset of glycoproteins. It also may function as a regulator of ERGIC-53.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum membrane, Golgi apparatus membrane |
| Tissue Specificity: | Expressed in numerous tissues. Highest expression in skeletal muscle and kidney, intermediate levels in heart, liver and placenta, low levels in brain, thymus, spleen, small intestine and lung. |
| BioGrid: | 123525. 48 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
