Recombinant Human Vasoactive Intestinal Peptide/VIP (C-6His)

Product code: 32-7914

Shipping Info:

Order now and get it on Tuesday February 25, 2025

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $334.00 

  • $527.00 

Add to Wish List

Shipping Info:

Order now and get it on Tuesday February 25, 2025

Same day delivery FREE on San Diego area orders placed by 1.00 PM


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGVDHHHHHH
Gene : VIP
Gene ID : 7432
Uniprot ID : P01282

Source: Human Cells.
MW :15.9kD.
Recombinant Human Vasoactive intestinal peptide is produced by our Mammalian expression system and the target gene encoding Ser21-Gly152 is expressed with a 6His tag at the C-terminus. Vasoactive intestinal peptide is also known as the vasoactive intestinal polypeptide or VIP. In humans, it is encoded by the VIP gene. VIP is neuropeptide which belongs to a glucagon/secretin superfamily, the ligand of class II G protein-coupled receptors. VIP is produced in many tissues of vertebrates including the gut, pancreas and suprachiasmatic nuclei of the hypothalamus in the brain. VIP stimulates contractility in the heart, causes vasodilation, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. VIP has a half-life in the blood of about two minutes.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
BioGrid: 113273. 9 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products