Recombinant Human V-Set and Transmembrane Domain-Containing 1/VSTM1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTVDHHHHHH |
Source: Human Cells.
MW :14.6kD.
Recombinant Human VSTM1 is produced by our Mammalian expression system and the target gene encoding Tyr17-Thr135 is expressed with a 6His tag at the C-terminus. V-set and transmembrane domain-containing protein 1 is a single-pass membrane protein. VSTM1 Contains 1 Ig-like V-type domain, in humans is encoded by the VSTM1 gene. It expressed on myeloid (neutrophils, eosinophils and monocytes) but not on lymphoid cells. It behaves as a cytokine, promoting IL17A secretion by CD4+ T-cells, and differentiation and activation of IL17 producing helper T-cells (TH17). Inhibitory immune receptor involved in the regulation of phagocytes.
MW :14.6kD.
Recombinant Human VSTM1 is produced by our Mammalian expression system and the target gene encoding Tyr17-Thr135 is expressed with a 6His tag at the C-terminus. V-set and transmembrane domain-containing protein 1 is a single-pass membrane protein. VSTM1 Contains 1 Ig-like V-type domain, in humans is encoded by the VSTM1 gene. It expressed on myeloid (neutrophils, eosinophils and monocytes) but not on lymphoid cells. It behaves as a cytokine, promoting IL17A secretion by CD4+ T-cells, and differentiation and activation of IL17 producing helper T-cells (TH17). Inhibitory immune receptor involved in the regulation of phagocytes.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Isoform 2 is N-glycosylated. |
| Tissue Specificity: | Expressed on myeloid (neutrophils, eosinophils and monocytes) but not on lymphoid cells. |
| BioGrid: | 129868. 12 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
