Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8 (C-Fc)(Discontinued)
![](images/categories/discont_prod_icon.jpg)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :54.2kD.
Recombinant Human V-Set and Ig Domain-Containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly263 is expressed with a Fc tag at the C-terminus. V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The human VSIG8 cDNA encodes 414 amino acids (aa) including a 21 aa signal sequence, a 242 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 130 aa cytoplasmic domain.The funtion of VSIG8 is not clear.
MW :54.2kD.
Recombinant Human V-Set and Ig Domain-Containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly263 is expressed with a Fc tag at the C-terminus. V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The human VSIG8 cDNA encodes 414 amino acids (aa) including a 21 aa signal sequence, a 242 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 130 aa cytoplasmic domain.The funtion of VSIG8 is not clear.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
There are currently no product reviews
|