Recombinant Human V-Set and Ig Domain-Containing Protein 2/VSIG2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAVDHHHHHH |
Source: Human Cells.
MW :24.2kD.
Recombinant Human VSIG2 is produced by our Mammalian expression system and the target gene encoding Val24-Ala243 is expressed with a 6His tag at the C-terminus. V-Set and Immunoglobulin Domain-Containing Protein 2 (VSIG2) is presumably a 50-60 kDa single-pass type I transmembrane (glyco)protein which contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. VSIG2 is highly expressed in the stomach, colon, prostate, trachea and thyroid glands and weakly in bladder and lung. V-set domains are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains, in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86, in myelin membrane adhesion molecules, in junction adhesion molecules (JAM), in tyrosine-protein kinase receptors, and in the programmed cell death protein 1 (PD1). It shows expression in stomach and prostate by Northern blot, and likely participates in cell adhesion. Human VSIG2 precursor is 327 amino acids in length.
MW :24.2kD.
Recombinant Human VSIG2 is produced by our Mammalian expression system and the target gene encoding Val24-Ala243 is expressed with a 6His tag at the C-terminus. V-Set and Immunoglobulin Domain-Containing Protein 2 (VSIG2) is presumably a 50-60 kDa single-pass type I transmembrane (glyco)protein which contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. VSIG2 is highly expressed in the stomach, colon, prostate, trachea and thyroid glands and weakly in bladder and lung. V-set domains are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains, in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86, in myelin membrane adhesion molecules, in junction adhesion molecules (JAM), in tyrosine-protein kinase receptors, and in the programmed cell death protein 1 (PD1). It shows expression in stomach and prostate by Northern blot, and likely participates in cell adhesion. Human VSIG2 precursor is 327 amino acids in length.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Highly expressed in stomach, colon, prostate, trachea and thyroid glands and weakly in bladder and lung. |
| BioGrid: | 117119. 30 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
