Recombinant Human Ubiquitin/ISG15-Conjugating Enzyme E2 L6/UBE2L6//UbcH8 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPSLEHHHHHH |
Source: E. coli.
MW :18.8kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 L6 is produced by our E.coli expression system and the target gene encoding Met1-Ser153 is expressed with a 6His tag at the C-terminus. Ubiquitin/ISG15-Conjugating Enzyme E2 L6 (UBE2L6) is an enzyme member of the E2 ubiquitin-conjugating enzyme family. UBE2L6 plays a same function as UBE2D, it catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. UBE2L6 promotes ubiquitination and subsequent proteasomal degradation of FLT3. It has functions in the E6/E6-AP-induced ubiquitination of p53/TP53.
MW :18.8kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 L6 is produced by our E.coli expression system and the target gene encoding Met1-Ser153 is expressed with a 6His tag at the C-terminus. Ubiquitin/ISG15-Conjugating Enzyme E2 L6 (UBE2L6) is an enzyme member of the E2 ubiquitin-conjugating enzyme family. UBE2L6 plays a same function as UBE2D, it catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. UBE2L6 promotes ubiquitination and subsequent proteasomal degradation of FLT3. It has functions in the E6/E6-AP-induced ubiquitination of p53/TP53.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Post transnational modification: | ISGylated. |
| Tissue Specificity: | Present in natural killer cells (at protein level). |
| BioGrid: | 114672. 52 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
