Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2/UBE2V2/DDVIT1 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 50mm HEPES,150mM NaCl, pH 7.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN |
Source: E. coli.
MW :18.5kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2 is produced by our E.coli expression system and the target gene encoding Met1-Asn145 is expressed with a 6His tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 Variant 2 (UBE2V2) is an enzyme that belongs to the ubiquitin-conjugating enzyme family. UBE2V2 can be detected in the placenta, colon, liver, and skin. It forms a heterodimer with UBE2N. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains and which leads to protein degradation by the proteasome. UBE2V2 mediates transcriptional activation of target genes. It plays a role in the control of progress through the cell cycle and differentiation. It also plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
MW :18.5kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2 is produced by our E.coli expression system and the target gene encoding Met1-Asn145 is expressed with a 6His tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 Variant 2 (UBE2V2) is an enzyme that belongs to the ubiquitin-conjugating enzyme family. UBE2V2 can be detected in the placenta, colon, liver, and skin. It forms a heterodimer with UBE2N. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains and which leads to protein degradation by the proteasome. UBE2V2 mediates transcriptional activation of target genes. It plays a role in the control of progress through the cell cycle and differentiation. It also plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Tissue Specificity: | Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues. |
| BioGrid: | 113184. 57 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
