Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3/UCH-L3 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 50mM TrisHCl, 150mM NaCl, 1mM DTT, 50% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAALEHHHHHH |
Source: E.coli.
MW :27.25kD.
Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3 is produced by our E.coli expression system and the target gene encoding Met1-Ala230 is expressed with a 6His tag at the C-terminus. Ubiquitin Carboxyl-Terminal Hydrolases (UCHs) are a family of cysteine hydrolases. They catalyze the hydrolysis of amides, thioesters and esters, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin. Up regulation of UCHL3 is associated with uterine cervical neoplasms. UCHL3 is implicated in age related cognitive disorders. UCHL3 also promotes adipogenesis and insulin signaling. In mice, UCHL3 knockout have been shown to be resistant to diet-induced obesity.
MW :27.25kD.
Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3 is produced by our E.coli expression system and the target gene encoding Met1-Ala230 is expressed with a 6His tag at the C-terminus. Ubiquitin Carboxyl-Terminal Hydrolases (UCHs) are a family of cysteine hydrolases. They catalyze the hydrolysis of amides, thioesters and esters, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin. Up regulation of UCHL3 is associated with uterine cervical neoplasms. UCHL3 is implicated in age related cognitive disorders. UCHL3 also promotes adipogenesis and insulin signaling. In mice, UCHL3 knockout have been shown to be resistant to diet-induced obesity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Highly expressed in heart, skeletal muscle, and testis. |
| BioGrid: | 113194. 89 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
![PE-Cy7 Conjugated Anti-CD34 / Mucosialin Monoclonal Antibody (Clone:4H11[APG])](https://d21vkl1rk084ej.cloudfront.net/images/30-1185PE-Cy7/1.jpg "PE-Cy7 Conjugated Anti-CD34 / Mucosialin Monoclonal Antibody (Clone:4H11[APG])")
