Recombinant Human U6 snRNA-Associated Sm-Like Protein LSm1/LSM1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEYVEHHHHHH |
Source: E.coli.
MW :16.23kD.
Recombinant Human LSM1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr133 is expressed with a 6His tag at the C-terminus. U6 snRNA-Associated Sm-Like Protein LSm1 (LSM1) belongs to the snRNP Sm proteins family. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which plays an important role in pre-mRNA splicing. LSM1 binds specifically to the 3-terminal U-tract of U6snRNA. LSM1 can interact with SLBP when histone mRNA is being rapidly degraded during the S phase. In addition, LSM1 is associated with cellular transformation and the progression of several malignancies including mesothelioma, lung cancer and breast cancer.
MW :16.23kD.
Recombinant Human LSM1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr133 is expressed with a 6His tag at the C-terminus. U6 snRNA-Associated Sm-Like Protein LSm1 (LSM1) belongs to the snRNP Sm proteins family. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which plays an important role in pre-mRNA splicing. LSM1 binds specifically to the 3-terminal U-tract of U6snRNA. LSM1 can interact with SLBP when histone mRNA is being rapidly degraded during the S phase. In addition, LSM1 is associated with cellular transformation and the progression of several malignancies including mesothelioma, lung cancer and breast cancer.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Cytoplasm |
| BioGrid: | 118104. 41 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
