Recombinant Human Tumor Necrosis Factor beta/TNF beta

Product code: 32-7159

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $383.00 

  • $597.00 

-->

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Gene : LTA
Gene ID : 4049
Uniprot ID : P01374
Source: E.coli.
MW :18.8kD.
Recombinant Human Tumor Necrosis Factor beta is produced by our E.coli expression system and the target gene encoding Leu35-Leu205 is expressed. Tumor Necrosis Factor beta (TNF- beta) is a secreted protein belonging to the tumor necrosis factor family. TNF- beta binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds to TNFRSF3/LTBR in heterotrimeric form with LTB. TNF- beta forms heterotrimers with lymphotoxin-beta, which anchors TNF- beta to the cell surface. TNF- beta mediates the inflammatory, immunostimulatory, and antiviral response, involves in the formation of second lymphoid organs during development, has a role in apoptosis. TNF- beta is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Biological Activity : The ED50 for this effect is typically 23 pg/mL.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted, Membrane
BioGrid: 110227. 8 interactions.
There are currently no product reviews

Customers who purchased this product also purchased