Recombinant Human Tryptase beta-2/TPSB2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | APAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPVDHHHHHH |
Source: Human Cells.
MW :29.64kD.
Recombinant Human Tryptase beta-2 is produced by our Mammalian expression system and the target gene encoding Ala19-Pro275 is expressed with a 6His tag at the C-terminus. Tryptases are Trypsin-like Serine Proteases. beta-Tryptases are the main isoenzymes in mast cells. b tryptases form active tetramers with heparin proteoglycan. In the tetramer, the unique arrangement of the active sites facing a narrow central pore, beta-Tryptases are resistant to macromolecule protease inhibitors . When mast cells are activated, beta-Tryptases are released and participate in provoking inflammatory conditions . beta-Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic disorders.
MW :29.64kD.
Recombinant Human Tryptase beta-2 is produced by our Mammalian expression system and the target gene encoding Ala19-Pro275 is expressed with a 6His tag at the C-terminus. Tryptases are Trypsin-like Serine Proteases. beta-Tryptases are the main isoenzymes in mast cells. b tryptases form active tetramers with heparin proteoglycan. In the tetramer, the unique arrangement of the active sites facing a narrow central pore, beta-Tryptases are resistant to macromolecule protease inhibitors . When mast cells are activated, beta-Tryptases are released and participate in provoking inflammatory conditions . beta-Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic disorders.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 122201. 16 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
