Recombinant Human Trypsin 1/TRP1/TRY1/TRYP1/PRSS1 (C-Fc-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 10 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | APFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Source: Human Cells.
MW :52.9kD.
Recombinant Human Trypsin 1 is produced by our Mammalian expression system and the target gene encoding Ala16-Ser247 is expressed with a Fc, 6His tag at the C-terminus. Trypsin-1, also known as Beta-trypsin, Cationic trypsinogen, Serine protease 1, Trypsin I, TRP1, TRY1, TRY4, TRYP1 and PRSS1, is a member of the trypsin family of serine proteases. PRSS1 contains one peptidase S1 domain and binds one calcium ion per subunit. PRSS1 is secreted by the pancreas and cleaved to its active form in the small intestine. Trypsin-1 is active on peptide linkages involving the carboxyl group of lysine or arginine. Defects in PRSS1 are a cause of pancreatitis (PCTT), which characterized by the presence of calculi in pancreatic ducts.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Occurs in a single-chain form and a two-chain form, produced by proteolytic cleavage after Arg-122. |
| BioGrid: | 111626. 23 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
