Recombinant Human Transforming Growth Factor beta-1/TGFB1
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 50mM Glycine 50mM NaCl pH4.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Source: Human Cells.
MW :12.8kD.
Recombinant Human Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming Growth Factor beta-1 (TGF beta-1) is a secreted protein which belongs to the TGF- beta family. TGF beta-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA). TGF beta-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGF beta-1 peptide. TGF beta-1 may also form heterodimers with other TGF beta family members. It has been found that TGF beta-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.
MW :12.8kD.
Recombinant Human Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming Growth Factor beta-1 (TGF beta-1) is a secreted protein which belongs to the TGF- beta family. TGF beta-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA). TGF beta-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGF beta-1 peptide. TGF beta-1 may also form heterodimers with other TGF beta family members. It has been found that TGF beta-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Latency-associated peptide: N-glycosylated (PubMed:3162913, PubMed:2493139, PubMed:28117447). Deglycosylation leads to activation of Transforming growth factor beta-1 (TGF-beta-1); mechanisms triggering deglycosylation-driven activation of TGF-beta-1 are however unclear (PubMed:2493139). |
| Tissue Specificity: | Highly expressed in bone (PubMed:11746498, PubMed:17827158). Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA) (PubMed:11746498, PubMed:17827158). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage (PubMed:17827158). |
| BioGrid: | 112898. 225 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
