Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial/MECR (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTMVDHHHHHH |
Source: Human Cells.
MW :35.7kD.
Recombinant Human Trans-2-Enoyl-CoA Reductase is produced by our Mammalian expression system and the target gene encoding Pro54-Met373 is expressed with a 6His tag at the C-terminus. Trans-2-Enoyl-CoA Reductase Mitochondrial (MECR) belongs to the zinc-containing alcohol dehydrogenase family. MECR localizes to the mitochondrion. It is highly expressed in skeletal and heart muscle and expressed at lower levels in the placenta, liver, kidney and pancreas, with weakly or no expression in the lung. MECR exists as a homodimer, which catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. MECR may take part in the mitochondrial synthesis of fatty acids.
MW :35.7kD.
Recombinant Human Trans-2-Enoyl-CoA Reductase is produced by our Mammalian expression system and the target gene encoding Pro54-Met373 is expressed with a 6His tag at the C-terminus. Trans-2-Enoyl-CoA Reductase Mitochondrial (MECR) belongs to the zinc-containing alcohol dehydrogenase family. MECR localizes to the mitochondrion. It is highly expressed in skeletal and heart muscle and expressed at lower levels in the placenta, liver, kidney and pancreas, with weakly or no expression in the lung. MECR exists as a homodimer, which catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. MECR may take part in the mitochondrial synthesis of fatty acids.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus |
| Tissue Specificity: | Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung. |
| BioGrid: | 119291. 17 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
