Recombinant Human Thy-1 Membrane Glycoprotein/THY1/CD90(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVK |
Source: E.coli.
MW :12.4kD.
Recombinant Human Thymus cell antigen 1 is produced by our E.coli expression system and the target gene encoding Gln20-Lys129 is expressed. Thy-1 membrane glycoprotein(THY1)is a 141 amino acids protein that contains 1 Ig-like V-type domain. Thy-1 is a 25–37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. Structural study of Thy-1 lead to the foundation of the Immunoglobulin superfamily, of which it is the smallest member, and led to some of the initial biochemical description and characterization of a vertebrate GPI anchor and also the first demonstration of tissue specific differential glycosylation. It may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
MW :12.4kD.
Recombinant Human Thymus cell antigen 1 is produced by our E.coli expression system and the target gene encoding Gln20-Lys129 is expressed. Thy-1 membrane glycoprotein(THY1)is a 141 amino acids protein that contains 1 Ig-like V-type domain. Thy-1 is a 25–37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. Structural study of Thy-1 lead to the foundation of the Immunoglobulin superfamily, of which it is the smallest member, and led to some of the initial biochemical description and characterization of a vertebrate GPI anchor and also the first demonstration of tissue specific differential glycosylation. It may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| BioGrid: | 112926. 37 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
