Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK |
Source: E.coli.
MW :39.2kD.
Recombinant Human PINX1 is produced by our E.coli expression system and the target gene encoding Met1-Lys328 is expressed with a 6His tag at the N-terminus. PIN2/TERF1-Interacting Telomerase Inhibitor 1 (PINX1) belongs to the PINX1 family . PINX1 contains a G-patch domain and a Telomerase Inhibiting Domain that is capable of binding MCRS1, TERT and TERF1. PINX1 is a widely expressed protein that localizes to nucleoli and telomere speckles. PINX1 can mediate TRF1 and TERT accumulation in nucleolus and enhance TRF1 binding to telomeres. PINX1 is recruited to chromosome periphery by Nucleolin, the complex is necessary for faithful chromosome congression. In addition, PINX1 may inhibit cell proliferation and act as tumor suppressor.
MW :39.2kD.
Recombinant Human PINX1 is produced by our E.coli expression system and the target gene encoding Met1-Lys328 is expressed with a 6His tag at the N-terminus. PIN2/TERF1-Interacting Telomerase Inhibitor 1 (PINX1) belongs to the PINX1 family . PINX1 contains a G-patch domain and a Telomerase Inhibiting Domain that is capable of binding MCRS1, TERT and TERF1. PINX1 is a widely expressed protein that localizes to nucleoli and telomere speckles. PINX1 can mediate TRF1 and TERT accumulation in nucleolus and enhance TRF1 binding to telomeres. PINX1 is recruited to chromosome periphery by Nucleolin, the complex is necessary for faithful chromosome congression. In addition, PINX1 may inhibit cell proliferation and act as tumor suppressor.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Nucleus, Chromosome, Chromosome |
| Tissue Specificity: | Ubiquitous; expressed at low levels. Not detectable in a number of hepatocarcinoma cell lines. |
| BioGrid: | 120319. 50 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
