Recombinant Human Syntenin-1/SDCBP/SYCL/MDA9 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEVLEHHHHHH |
Source: E. coli.
MW :33.5kD.
Recombinant Human Syntenin-1 is produced by our E.coli expression system and the target gene encoding Ser2-Val298 is expressed with a 6His tag at the C-terminus. Syntenin-1 is a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but also found at the endoplasmic reticulum and nucleus. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. Syntenin-1 may affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. It seems to function as an adapter protein, in adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Syntenin-1 seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA) and play a role in vesicular trafficking.
MW :33.5kD.
Recombinant Human Syntenin-1 is produced by our E.coli expression system and the target gene encoding Ser2-Val298 is expressed with a 6His tag at the C-terminus. Syntenin-1 is a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but also found at the endoplasmic reticulum and nucleus. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. Syntenin-1 may affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. It seems to function as an adapter protein, in adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Syntenin-1 seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA) and play a role in vesicular trafficking.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell junction, Cell junction, Cell membrane, Endoplasmic reticulum membrane, Nucleus, Melanosome, Cytoplasm, Cytoplasm, Secreted, Membrane raft |
| Post transnational modification: | Phosphorylated on tyrosine residues. |
| Tissue Specificity: | Expressed in lung cancers, including adenocarcinoma, squamous cell carcinoma and small-cell carcinoma (at protein level) (PubMed:25893292). Widely expressed. Expressed in fetal kidney, liver, lung and brain. In adult highest expression in heart and placenta. |
| BioGrid: | 112287. 213 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
