Recombinant Human Sulfotransferase 1A3/SULT1A3 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris,100mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Source: E. coli.
MW :35.6kD.
Recombinant Human Sulfotransferase 1A3 is produced by our E.coli expression system and the target gene encoding Met1-Leu295 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1A3/1A4 (SULT1A3) is 295 amino acids in length and localizes to the cytoplasm. It is a member of the Sulfotransferase 1 family. SULT1A3 can be found in the liver, colon, kidney, lung, brain, spleen, small intestine, placenta, and leukocytes. SULT1A3 exists as a homodimer and it catalyzes the sulfation of phenolic monoamines, such as dopamine, norepinephrine and serotonin, and phenolic and catecholic drugs.
MW :35.6kD.
Recombinant Human Sulfotransferase 1A3 is produced by our E.coli expression system and the target gene encoding Met1-Leu295 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1A3/1A4 (SULT1A3) is 295 amino acids in length and localizes to the cytoplasm. It is a member of the Sulfotransferase 1 family. SULT1A3 can be found in the liver, colon, kidney, lung, brain, spleen, small intestine, placenta, and leukocytes. SULT1A3 exists as a homodimer and it catalyzes the sulfation of phenolic monoamines, such as dopamine, norepinephrine and serotonin, and phenolic and catecholic drugs.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Post transnational modification: | The N-terminus is blocked. |
| Tissue Specificity: | Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte. |
| BioGrid: | 138644. 4 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
