Recombinant Human Small Ubiquitin-Related Modifier 3/SUMO3/SMT3A (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF |
Source: E.coli.
MW :13.8kD.
Recombinant Human SUMO3 is produced by our E.coli expression system and the target gene encoding Met1-Phe103 is expressed with a 6His tag at the N-terminus. SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease.
MW :13.8kD.
Recombinant Human SUMO3 is produced by our E.coli expression system and the target gene encoding Met1-Phe103 is expressed with a 6His tag at the N-terminus. SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Nucleus |
| Post transnational modification: | Cleavage of precursor form by SENP1, SENP2 or SENP5 is necessary for function. |
| Tissue Specificity: | Expressed predominantly in liver. |
| BioGrid: | 112496. 72 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
