Recombinant Human Signaling Threshold-Regulating TM Adapter 1/SIT1 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris, 250mM Nacl, 2mM EDTA, pH 8.0 . |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAASLEHHHHHH |
Source: E.coli.
MW :17.65kD.
Recombinant Human SIT1 is produced by our E.coli expression system and the target gene encoding Gln65-Ser196 is expressed with a 6His tag at the N-terminus. Signaling Threshold-Regulating Transmembrane Adapter 1 (SIT1) is a single-pass type I membrane protein and specifically expressed in T- and B-cells. SIT1 interacts with PTPN11/SHP2, GRB2 and CSK, when it is phosphorylated. SIT1 negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cell. In addition, SIT1 is involved in positive selection of T-cells.
MW :17.65kD.
Recombinant Human SIT1 is produced by our E.coli expression system and the target gene encoding Gln65-Ser196 is expressed with a 6His tag at the N-terminus. Signaling Threshold-Regulating Transmembrane Adapter 1 (SIT1) is a single-pass type I membrane protein and specifically expressed in T- and B-cells. SIT1 interacts with PTPN11/SHP2, GRB2 and CSK, when it is phosphorylated. SIT1 negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cell. In addition, SIT1 is involved in positive selection of T-cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated on tyrosines by LCK, FYN or ZAP70 upon TCR activation; which leads to the recruitment of PTPN11, GRB2 and CSK. |
| Tissue Specificity: | Specifically expressed in T- and B-cells. Present in plasma cells but not in germinal center B-cells (at protein level). Expressed in T- and B-cell lymphoma. |
| BioGrid: | 118088. 5 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
