Recombinant Human Secretogranin-3/SCG3 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | FPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAAFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSLVDHHHHHH |
Source: Human Cells.
MW :52kD.
Recombinant Human Secretogranin-3 is produced by our Mammalian expression system and the target gene encoding Phe20-Leu468 is expressed with a 6His tag at the C-terminus. Secretogranin-3(SCG3) is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. SCG3 is expressed in brain, heart, kidney, liver and skeletal muscle. It may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones; however, the function of this protein is unknown.
MW :52kD.
Recombinant Human Secretogranin-3 is produced by our Mammalian expression system and the target gene encoding Phe20-Leu468 is expressed with a 6His tag at the C-terminus. Secretogranin-3(SCG3) is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. SCG3 is expressed in brain, heart, kidney, liver and skeletal muscle. It may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones; however, the function of this protein is unknown.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasmic vesicle, Cytoplasmic vesicle, Secreted |
| Post transnational modification: | O-glycosylated. |
| Tissue Specificity: | Expressed in brain, heart, kidney, liver and skeletal muscle. |
| BioGrid: | 118874. 6 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
